PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_23792.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family B3
Protein Properties Length: 223aa    MW: 25452 Da    PI: 4.3778
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_23792.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B334.14.8e-114425999
                             EEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                       B3 59 yvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                              ++t+GW++F+++++Lk+g+f++F +dg+++f   v+vf +
  Rsa1.0_23792.1_g00001.1  4 AYFTSGWSKFAEDHELKDGEFLTFVYDGSHTF--EVSVFGR 42
                             589***********************998888..8888766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086311.575143IPR003340B3 DNA binding domain
CDDcd100178.71E-10140No hitNo description
SuperFamilySSF1019362.16E-12345IPR015300DNA-binding pseudobarrel domain
PfamPF023626.5E-8441IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.3E-11445IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.8E-6127206IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.46E-9127206IPR015300DNA-binding pseudobarrel domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
RDCAYFTSGW SKFAEDHELK DGEFLTFVYD GSHTFEVSVF GRSGCKEMRA VVETVNLSDA  60
NSEEEEEEDS SVAADSNEEE EEEGDDDPSF DAGEDERVSQ SLYPVDSDDT VSNAEVVAGF  120
SNLEVESNPW FTTTLKNRIY ELLIPANVVK EHGLTFCDRI KYIDAEGIMH GAKGKWSDDR  180
ICFKGWDRIC RRNRLKEFDI VHCEMLHIRK KVHSIKITIT RGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892221e-78AC189222.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB010M19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013750018.11e-134PREDICTED: B3 domain-containing protein REM20-like isoform X1
RefseqXP_013750020.11e-134PREDICTED: B3 domain-containing protein REM20-like isoform X1
RefseqXP_013750021.11e-134PREDICTED: B3 domain-containing protein REM20-like isoform X1
RefseqXP_013750022.11e-134PREDICTED: B3 domain-containing protein REM20-like isoform X1
SwissprotQ8LAV52e-73REM20_ARATH; B3 domain-containing protein REM20
TrEMBLA0A078FJC51e-129A0A078FJC5_BRANA; BnaC06g14560D protein
TrEMBLM4CFZ81e-129M4CFZ8_BRARP; Uncharacterized protein
STRINGBra003130.1-P1e-129(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15612380
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53310.13e-68B3 family protein